CPEB3 antibody (Middle Region)

Catalog No. ABIN632985

Product Details anti-CPEB3 Antibody

Target: CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPEB3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CPEB3 antibody was raised against the middle region of CPEB3

Purification: Affinity purified

Immunogen: CPEB3 antibody was raised using the middle region of CPEB3 corresponding to a region with amino acids RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPEB3 Blocking Peptide, catalog no. 33R-8220, is also available for use as a blocking control in assays to test for specificity of this CPEB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPEB3

Target: CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))

Alternative Name: CPEB3 (CPEB3 Products)

Synonyms: si:ch211-129m12.2 antibody, 4831444O18Rik antibody, mKIAA0940 antibody, RGD1564670 antibody, cytoplasmic polyadenylation element binding protein 3 antibody, cpeb3 antibody, CPEB3 antibody, LOAG_07772 antibody, Cpeb3 antibody

Background: The function of CPEB3 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 76 kDa (MW of target protein)