TTC35 antibody (Middle Region)

Catalog No. ABIN632993

Product Details anti-TTC35 Antibody

Target: TTC35 (Tetratricopeptide Repeat Domain 35 (TTC35))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTC35 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TTC35 antibody was raised against the middle region of TTC35

Purification: Affinity purified

Immunogen: TTC35 antibody was raised using the middle region of TTC35 corresponding to a region with amino acids IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TTC35 Blocking Peptide, catalog no. 33R-4119, is also available for use as a blocking control in assays to test for specificity of this TTC35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTC35

Target: TTC35 (Tetratricopeptide Repeat Domain 35 (TTC35))

Alternative Name: TTC35 (TTC35 Products)

Synonyms: TTC35 antibody, KIAA0103 antibody, kiaa0103 antibody, ttc35 antibody, 4921531G14Rik antibody, AV060620 antibody, AW209495 antibody, Ttc35 antibody, RGD1310430 antibody, emc2-b antibody, ttc35-b antibody, zgc:73154 antibody, zgc:86891 antibody, ER membrane protein complex subunit 2 antibody, tetratricopeptide repeat domain 35 antibody, ER membrane protein complex subunit 2 S homeolog antibody, EMC2 antibody, emc2 antibody, CC1G_12481 antibody, Ttc35 antibody, Emc2 antibody, emc2.S antibody

Background: The function of TTC35 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 35 kDa (MW of target protein)