OTUB1 antibody (Middle Region)

Catalog No. ABIN632994

Product Details anti-OTUB1 Antibody

Target: OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OTUB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OTUB1 antibody was raised against the middle region of OTUB1

Purification: Affinity purified

Immunogen: OTUB1 antibody was raised using the middle region of OTUB1 corresponding to a region with amino acids KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OTUB1 Blocking Peptide, catalog no. 33R-4432, is also available for use as a blocking control in assays to test for specificity of this OTUB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OTUB1

Target: OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))

Alternative Name: OTUB1 (OTUB1 Products)

Synonyms: OTB1 antibody, OTU1 antibody, AI850305 antibody, fa19h07 antibody, otub1 antibody, wu:fa19h07 antibody, zgc:92839 antibody, MGC131231 antibody, fb17f04 antibody, otub1l antibody, wu:fb17f04 antibody, zgc:92685 antibody, OTU deubiquitinase, ubiquitin aldehyde binding 1 antibody, OTU domain, ubiquitin aldehyde binding 1 antibody, OTU deubiquitinase, ubiquitin aldehyde binding 1b antibody, OTU deubiquitinase, ubiquitin aldehyde binding 1 L homeolog antibody, similar to HSPC263 antibody, OTU deubiquitinase, ubiquitin aldehyde binding 1a antibody, OTUB1 antibody, Otub1 antibody, otub1b antibody, otub1.L antibody, otub1 antibody, RGD1565010 antibody, otub1a antibody

Background: The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin.

Molecular Weight: 31 kDa (MW of target protein)