MARK3 antibody (Middle Region)

Catalog No. ABIN633022

Product Details anti-MARK3 Antibody

Target: MARK3 (MAP/microtubule Affinity-Regulating Kinase 3 (MARK3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MARK3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MARK3 antibody was raised against the middle region of MARK3

Purification: Affinity purified

Immunogen: MARK3 antibody was raised using the middle region of MARK3 corresponding to a region with amino acids ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MARK3 Blocking Peptide, catalog no. 33R-1579, is also available for use as a blocking control in assays to test for specificity of this MARK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MARK3

Target: MARK3 (MAP/microtubule Affinity-Regulating Kinase 3 (MARK3))

Alternative Name: MARK3 (MARK3 Products)

Synonyms: MARK3 antibody, par1 antibody, par-1 antibody, Par-1A antibody, CTAK1 antibody, KP78 antibody, PAR1A antibody, Par-1a antibody, 1600015G02Rik antibody, A430080F22Rik antibody, C-TAK1 antibody, ETK-1 antibody, ETK1 antibody, Emk2 antibody, MPK10 antibody, fi39g08 antibody, wu:fi39g08 antibody, zgc:152848 antibody, zgc:55693 antibody, c-tak1 antibody, ctak1 antibody, emk-2 antibody, microtubule affinity regulating kinase 3 antibody, MAP/microtubule affinity-regulating kinase 3b antibody, MAP/microtubule affinity regulating kinase 3 antibody, MAP/microtubule affinity-regulating kinase 3a antibody, microtubule affinity regulating kinase 3 L homeolog antibody, MARK3 antibody, mark3b antibody, mark3 antibody, Mark3 antibody, mark3a antibody, mark3.L antibody

Background: MARK3 is involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.

Molecular Weight: 81 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome