MRPS6 antibody (Middle Region)

Catalog No. ABIN633030

Product Details anti-MRPS6 Antibody

Target: MRPS6 (Mitochondrial Ribosomal Protein S6 (MRPS6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPS6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPS6 antibody was raised against the middle region of MRPS6

Purification: Affinity purified

Immunogen: MRPS6 antibody was raised using the middle region of MRPS6 corresponding to a region with amino acids VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPS6 Blocking Peptide, catalog no. 33R-9511, is also available for use as a blocking control in assays to test for specificity of this MRPS6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPS6

Target: MRPS6 (Mitochondrial Ribosomal Protein S6 (MRPS6))

Alternative Name: MRPS6 (MRPS6 Products)

Synonyms: C21orf101 antibody, MRP-S6 antibody, RPMS6 antibody, S6mt antibody, AW046321 antibody, BcDNA:RH10862 antibody, CG15016 antibody, Dmel\\CG15016 antibody, Mrps6 antibody, zgc:153390 antibody, mitochondrial ribosomal protein S6 antibody, MRPS6 antibody, Mrps6 antibody, mRpS6 antibody, mrps6 antibody

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology.

Molecular Weight: 14 kDa (MW of target protein)