FZR1 antibody

Catalog No. ABIN633045

Product Details anti-FZR1 Antibody

Target: FZR1 (Fizzy/cell Division Cycle 20 Related 1 (FZR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZR1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FZR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FZR1 Blocking Peptide, catalog no. 33R-8839, is also available for use as a blocking control in assays to test for specificity of this FZR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FZR1

Target: FZR1 (Fizzy/cell Division Cycle 20 Related 1 (FZR1))

Alternative Name: FZR1 (FZR1 Products)

Synonyms: CDH1-C antibody, FYR antibody, FZR antibody, CDH1 antibody, fzr1 antibody, CDC20C antibody, FZR2 antibody, HCDH antibody, HCDH1 antibody, AW108046 antibody, Cdh1 antibody, Fyr antibody, zgc:55450 antibody, fizzy and cell division cycle 20 related 1 antibody, fizzy/cell division cycle 20 related 1 antibody, fizzy-related protein homolog antibody, fizzy/cell division cycle 20 related 1 (Drosophila) antibody, fizzy/cell division cycle 20 related 1a antibody, Fzr1 antibody, CDH1-C antibody, FZR1 antibody, LOC100027495 antibody, LOC100179951 antibody, fzr1a antibody

Background: FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: DNA Replication, Synthesis of DNA