PLEKHO1 antibody (N-Term)

Catalog No. ABIN633055

Product Details anti-PLEKHO1 Antibody

Target: PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLEKHO1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLEKHO1 antibody was raised against the N terminal of PLEKHO1

Purification: Affinity purified

Immunogen: PLEKHO1 antibody was raised using the N terminal of PLEKHO1 corresponding to a region with amino acids MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLEKHO1 Blocking Peptide, catalog no. 33R-6233, is also available for use as a blocking control in assays to test for specificity of this PLEKHO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLEKHO1

Target: PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1))

Alternative Name: PLEKHO1 (PLEKHO1 Products)

Synonyms: CKIP-1 antibody, OC120 antibody, 2810052M02Rik antibody, Ckip1 antibody, JZA-20 antibody, Jza2 antibody, RGD1311487 antibody, ckip-1 antibody, plekho1 antibody, si:dkey-200h23.2 antibody, pleckstrin homology domain containing O1 antibody, pleckstrin homology domain containing, family O member 1 antibody, pleckstrin homology domain containing, family O member 1a antibody, PLEKHO1 antibody, Plekho1 antibody, plekho1a antibody

Background: PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.

Molecular Weight: 46 kDa (MW of target protein)