DCC antibody (Middle Region)

Catalog No. ABIN633057

Product Details anti-DCC Antibody

Target: DCC (Deleted in Colorectal Carcinoma (DCC))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DCC antibody was raised against the middle region of DCC

Purification: Affinity purified

Immunogen: DCC antibody was raised using the middle region of DCC corresponding to a region with amino acids PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCC Blocking Peptide, catalog no. 33R-7153, is also available for use as a blocking control in assays to test for specificity of this DCC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCC

Target: DCC (Deleted in Colorectal Carcinoma (DCC))

Alternative Name: DCC (DCC Products)

Synonyms: CRC18 antibody, CRCR1 antibody, IGDCC1 antibody, MRMV1 antibody, DCC antibody, zdcc antibody, C030036D22Rik antibody, Igdcc1 antibody, xdcc antibody, XDCCa antibody, dcca-A antibody, Dcc antibody, DCC netrin 1 receptor antibody, deleted in colorectal carcinoma antibody, netrin receptor DCC antibody, DCC antibody, dcc antibody, Dcc antibody, LOC100712666 antibody

Background: This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma.

Molecular Weight: 158 kDa (MW of target protein)

Pathways: Regulation of Cell Size