HLA-DQA2 antibody (N-Term)
-
- Target See all HLA-DQA2 Antibodies
- HLA-DQA2 (Major Histocompatibility Complex, Class II, DQ alpha 2 (HLA-DQA2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HLA-DQA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HLA-DQA2 antibody was raised against the N terminal of HLA-DQA2
- Purification
- Affinity purified
- Immunogen
- HLA-DQA2 antibody was raised using the N terminal of HLA-DQA2 corresponding to a region with amino acids GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS
- Top Product
- Discover our top product HLA-DQA2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HLA-DQA2 Blocking Peptide, catalog no. 33R-3648, is also available for use as a blocking control in assays to test for specificity of this HLA-DQA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DQA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HLA-DQA2 (Major Histocompatibility Complex, Class II, DQ alpha 2 (HLA-DQA2))
- Alternative Name
- HLA-DQA2 (HLA-DQA2 Products)
- Synonyms
- DX-ALPHA antibody, HLA-DXA antibody, major histocompatibility complex, class II, DQ alpha 2 antibody, HLA-DQA2 antibody
- Background
- This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognised by CD4 T-cells.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- TCR Signaling
-