MITD1 antibody (Middle Region)
-
- Target See all MITD1 Antibodies
- MITD1 (MIT, Microtubule Interacting and Transport, Domain Containing 1 (MITD1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MITD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MITD1 antibody was raised against the middle region of MITD1
- Purification
- Affinity purified
- Immunogen
- MITD1 antibody was raised using the middle region of MITD1 corresponding to a region with amino acids SHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDF
- Top Product
- Discover our top product MITD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MITD1 Blocking Peptide, catalog no. 33R-8509, is also available for use as a blocking control in assays to test for specificity of this MITD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MITD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MITD1 (MIT, Microtubule Interacting and Transport, Domain Containing 1 (MITD1))
- Alternative Name
- MITD1 (MITD1 Products)
- Synonyms
- zgc:56159 antibody, MGC88990 antibody, MGC128843 antibody, MGC115722 antibody, 1500032H18Rik antibody, RGD1307700 antibody, MIT, microtubule interacting and transport, domain containing 1 antibody, microtubule interacting and trafficking domain containing 1 antibody, microtubule interacting and trafficking domain containing 1 L homeolog antibody, mitd1 antibody, MITD1 antibody, mitd1.L antibody, Mitd1 antibody
- Background
- MITD1 may play a role in endosomal protein transport.
- Molecular Weight
- 29 kDa (MW of target protein)
-