VAT1 antibody

Catalog No. ABIN633081

Product Details anti-VAT1 Antibody

Target: VAT1 (Vesicle Amine Transport 1 (VAT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VAT1 Blocking Peptide, catalog no. 33R-7240, is also available for use as a blocking control in assays to test for specificity of this VAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VAT1

Target: VAT1 (Vesicle Amine Transport 1 (VAT1))

Alternative Name: VAT1 (VAT1 Products)

Synonyms: VATI antibody, VAT-1 antibody, SLC18A1 antibody, si:dz163l24.2 antibody, Protein MIB antibody, vat1 antibody, vesicle amine transport 1 antibody, vesicle amine transport 1 L homeolog antibody, VAT1 antibody, Vat1 antibody, vat1 antibody, vat1.L antibody

Background: Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.

Molecular Weight: 42 kDa (MW of target protein)