ATP8B2 antibody (N-Term)
-
- Target See all ATP8B2 Antibodies
- ATP8B2 (ATPase, Aminophospholipid Transporter, Class I, Type 8B, Member 2 (ATP8B2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP8B2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP8 B2 antibody was raised against the N terminal of ATP8 2
- Purification
- Affinity purified
- Immunogen
- ATP8 B2 antibody was raised using the N terminal of ATP8 2 corresponding to a region with amino acids KTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVP
- Top Product
- Discover our top product ATP8B2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP8B2 Blocking Peptide, catalog no. 33R-4690, is also available for use as a blocking control in assays to test for specificity of this ATP8B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP8B2 (ATPase, Aminophospholipid Transporter, Class I, Type 8B, Member 2 (ATP8B2))
- Alternative Name
- ATP8B2 (ATP8B2 Products)
- Synonyms
- Id antibody, ATPID antibody, fc09b04 antibody, wu:fc09b04 antibody, ATPase, class I, type 8B, member 2 antibody, ATPase phospholipid transporting 8B2 antibody, ATPase, aminophospholipid transporter, class I, type 8B, member 2 antibody, Atp8b2 antibody, ATP8B2 antibody, atp8b2 antibody
- Background
- The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molecular Weight
- 44 kDa (MW of target protein)
-