ATP6AP1 antibody (Middle Region)

Catalog No. ABIN633093

Product Details anti-ATP6AP1 Antibody

Target: ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP6AP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATP6 AP1 antibody was raised against the middle region of ATP6 P1

Purification: Affinity purified

Immunogen: ATP6 AP1 antibody was raised using the middle region of ATP6 P1 corresponding to a region with amino acids SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP6AP1 Blocking Peptide, catalog no. 33R-8700, is also available for use as a blocking control in assays to test for specificity of this ATP6AP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP6AP1

Target: ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))

Alternative Name: ATP6AP1 (ATP6AP1 Products)

Synonyms: 16A antibody, ATP6IP1 antibody, ATP6S1 antibody, Ac45 antibody, CF2 antibody, VATPS1 antibody, XAP-3 antibody, XAP3 antibody, AC45 antibody, AI316502 antibody, AW108110 antibody, Atp6ip1 antibody, Atp6s1 antibody, C7-1 antibody, mFLJ00383 antibody, H+-ATPase antibody, ATPase H+ transporting accessory protein 1 antibody, ATPase, H+ transporting, lysosomal accessory protein 1 antibody, plasma membrane ATPase 4 antibody, ATP6AP1 antibody, Atp6ap1 antibody, LOC547525 antibody

Background: This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kDa and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Proton Transport, SARS-CoV-2 Protein Interactome