CSH1 antibody (Middle Region)

Catalog No. ABIN633099

Product Details anti-CSH1 Antibody

Target: CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSH1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CSH2 antibody was raised against the middle region of CSH2

Purification: Affinity purified

Immunogen: CSH2 antibody was raised using the middle region of CSH2 corresponding to a region with amino acids LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSH2 Blocking Peptide, catalog no. 33R-4935, is also available for use as a blocking control in assays to test for specificity of this CSH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSH1

Target: CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))

Alternative Name: CSH2 (CSH1 Products)

Background: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation, an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus