CSH1 antibody (Middle Region)
-
- Target See all CSH1 Antibodies
- CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CSH2 antibody was raised against the middle region of CSH2
- Purification
- Affinity purified
- Immunogen
- CSH2 antibody was raised using the middle region of CSH2 corresponding to a region with amino acids LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH
- Top Product
- Discover our top product CSH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CSH2 Blocking Peptide, catalog no. 33R-4935, is also available for use as a blocking control in assays to test for specificity of this CSH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))
- Alternative Name
- CSH2 (CSH1 Products)
- Background
- The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation, an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues.
- Molecular Weight
- 14 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus
-