STK38L antibody (Middle Region)

Catalog No. ABIN633103

Product Details anti-STK38L Antibody

Target: STK38L (serine/threonine Kinase 38 Like (STK38L))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STK38L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STK38 L antibody was raised against the middle region of STK38

Purification: Affinity purified

Immunogen: STK38 L antibody was raised using the middle region of STK38 corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STK38L Blocking Peptide, catalog no. 33R-6952, is also available for use as a blocking control in assays to test for specificity of this STK38L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STK38L

Target: STK38L (serine/threonine Kinase 38 Like (STK38L))

Alternative Name: STK38L (STK38L Products)

Synonyms: RGD1564793 antibody, NDR2 antibody, 4930473A22Rik antibody, B230328I19 antibody, Ndr2 antibody, Ndr54 antibody, serine/threonine kinase 38 like antibody, Stk38l antibody, STK38L antibody

Background: STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

Molecular Weight: 54 kDa (MW of target protein)