UBXN10 antibody (Middle Region)

Catalog No. ABIN633121

Product Details anti-UBXN10 Antibody

Target: UBXN10 (UBX Domain Protein 10 (UBXN10))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBXN10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UBXD3 antibody was raised against the middle region of UBXD3

Purification: Affinity purified

Immunogen: UBXD3 antibody was raised using the middle region of UBXD3 corresponding to a region with amino acids PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBXD3 Blocking Peptide, catalog no. 33R-7443, is also available for use as a blocking control in assays to test for specificity of this UBXD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBXD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBXN10

Target: UBXN10 (UBX Domain Protein 10 (UBXN10))

Alternative Name: UBXD3 (UBXN10 Products)

Synonyms: UBXD3 antibody, zgc:153648 antibody, 5730509E04Rik antibody, A830047D02 antibody, Ubxd3 antibody, UBX domain protein 10 antibody, UBX domain protein 10 L homeolog antibody, UBXN10 antibody, ubxn10 antibody, ubxn10.L antibody, Ubxn10 antibody

Background: The function of UBXD3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 31 kDa (MW of target protein)