ZDHHC21 antibody (Middle Region)

Catalog No. ABIN633123

Product Details anti-ZDHHC21 Antibody

Target: ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC21 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZDHHC21 antibody was raised against the middle region of ZDHHC21

Purification: Affinity purified

Immunogen: ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC21 Blocking Peptide, catalog no. 33R-2559, is also available for use as a blocking control in assays to test for specificity of this ZDHHC21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC21

Target: ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))

Alternative Name: ZDHHC21 (ZDHHC21 Products)

Synonyms: 9130404H11Rik antibody, AL024349 antibody, D130004H04Rik antibody, dep antibody, DHHC-21 antibody, DHHC21 antibody, DNZ1 antibody, HSPC097 antibody, zinc finger DHHC-type containing 21 antibody, zinc finger, DHHC domain containing 21 antibody, zinc finger, DHHC-type containing 21 antibody, ZDHHC21 antibody, zdhhc21 antibody, Zdhhc21 antibody

Background: The function of ZDHHC21 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 31 kDa (MW of target protein)