SUV39H2 antibody

Catalog No. ABIN633133

Product Details anti-SUV39H2 Antibody

Target: SUV39H2 (Suppressor of Variegation 3-9 Homolog 2 (Drosophila) (SUV39H2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUV39H2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SUV39 H2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SUV39H2 Blocking Peptide, catalog no. 33R-4870, is also available for use as a blocking control in assays to test for specificity of this SUV39H2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUV30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SUV39H2

Target: SUV39H2 (Suppressor of Variegation 3-9 Homolog 2 (Drosophila) (SUV39H2))

Alternative Name: SUV39H2 (SUV39H2 Products)

Synonyms: KMT1B antibody, 4930507K23Rik antibody, AA536750 antibody, D030054H19Rik antibody, D2Ertd544e antibody, SUV39H2 antibody, kmt1b antibody, suppressor of variegation 3-9 homolog 2 antibody, suppressor of variegation 3-9 homolog 2 (Drosophila) antibody, suppressor of variegation 3-9 homolog 2 L homeolog antibody, SUV39H2 antibody, Suv39h2 antibody, suv39h2 antibody, suv39h2.L antibody

Background: SUV39H2 is a histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats.

Molecular Weight: 40 kDa (MW of target protein)