GLCCI1 antibody (Middle Region)

Catalog No. ABIN633144

Product Details anti-GLCCI1 Antibody

Target: GLCCI1 (Glucocorticoid Induced Transcript 1 (GLCCI1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLCCI1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLCCI1 antibody was raised against the middle region of GLCCI1

Purification: Affinity purified

Immunogen: GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLCCI1 Blocking Peptide, catalog no. 33R-7448, is also available for use as a blocking control in assays to test for specificity of this GLCCI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLCCI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLCCI1

Target: GLCCI1 (Glucocorticoid Induced Transcript 1 (GLCCI1))

Alternative Name: GLCCI1 (GLCCI1 Products)

Synonyms: FAM117C antibody, GCTR antibody, GIG18 antibody, TSSN1 antibody, 2310047L21Rik antibody, A130036A18Rik antibody, Fam117c antibody, Gig18 antibody, Tssn1 antibody, sb:cb902 antibody, testhymin antibody, zgc:158237 antibody, RGD1563612 antibody, glucocorticoid induced 1 antibody, glucocorticoid induced transcript 1 antibody, glucocorticoid induced 1a antibody, glucocorticoid induced 1 L homeolog antibody, GLCCI1 antibody, Glcci1 antibody, glcci1a antibody, glcci1.L antibody

Background: The function of GLCCI protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 58 kDa (MW of target protein)