APBB3 antibody

Catalog No. ABIN633150

Product Details anti-APBB3 Antibody

Target: APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APBB3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: APBB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APBB3 Blocking Peptide, catalog no. 33R-8950, is also available for use as a blocking control in assays to test for specificity of this APBB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APBB3

Target: APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))

Alternative Name: APBB3 (APBB3 Products)

Synonyms: Fe65l2 antibody, Rirl2 antibody, TR2S antibody, MGC142933 antibody, FE65L2 antibody, SRA antibody, amyloid beta (A4) precursor protein-binding, family B, member 3 antibody, steroid receptor RNA activator 1 antibody, amyloid beta precursor protein binding family B member 3 antibody, Apbb3 antibody, SRA1 antibody, APBB3 antibody, apbb3 antibody

Background: The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.

Molecular Weight: 52 kDa (MW of target protein)