ASZ1 antibody (Middle Region)
-
- Target See all ASZ1 Antibodies
- ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain Containing 1 (ASZ1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASZ1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ASZ1 antibody was raised against the middle region of ASZ1
- Purification
- Affinity purified
- Immunogen
- ASZ1 antibody was raised using the middle region of ASZ1 corresponding to a region with amino acids GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR
- Top Product
- Discover our top product ASZ1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASZ1 Blocking Peptide, catalog no. 33R-3373, is also available for use as a blocking control in assays to test for specificity of this ASZ1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASZ1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain Containing 1 (ASZ1))
- Alternative Name
- ASZ1 (ASZ1 Products)
- Synonyms
- Gasz antibody, GASZ antibody, gasz antibody, MGC56332 antibody, zgc:56332 antibody, ALP1 antibody, ANKL1 antibody, C7orf7 antibody, CT1.19 antibody, Orf3 antibody, 4933400N19Rik antibody, ORF3 antibody, ankyrin repeat, SAM and basic leucine zipper domain containing 1 antibody, Asz1 antibody, ASZ1 antibody, asz1 antibody
- Background
- ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.
- Molecular Weight
- 53 kDa (MW of target protein)
-