HSD17B11 antibody

Catalog No. ABIN633162

Product Details anti-HSD17B11 Antibody

Target: HSD17B11 (Hydroxysteroid (17-Beta) Dehydrogenase 11 (HSD17B11))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD17B11 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HSD17 B11 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSD17B11 Blocking Peptide, catalog no. 33R-9080, is also available for use as a blocking control in assays to test for specificity of this HSD17B11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSD17B11

Target: HSD17B11 (Hydroxysteroid (17-Beta) Dehydrogenase 11 (HSD17B11))

Alternative Name: HSD17B11 (HSD17B11 Products)

Synonyms: 17BHSD11 antibody, DHRS8 antibody, PAN1B antibody, RETSDR2 antibody, SDR16C2 antibody, Dhrs8 antibody, HSD17B13 antibody, MGC84756 antibody, HSD17B11 antibody, Pan1b antibody, SDR2 antibody, retSDR2 antibody, 17-beta-HSD 11 antibody, 17-beta-HSD XI antibody, 17bHSD11 antibody, 17betaHSD11 antibody, 17betaHSDXI antibody, hydroxysteroid 17-beta dehydrogenase 11 antibody, hydroxysteroid (17-beta) dehydrogenase 11 antibody, hydroxysteroid (17-beta) dehydrogenase 11 L homeolog antibody, estradiol 17-beta-dehydrogenase 11 antibody, HSD17B11 antibody, Hsd17b11 antibody, hsd17b11.L antibody, hsd17b11 antibody, LOC100348005 antibody, LOC100520923 antibody

Background: Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones.

Molecular Weight: 33 kDa (MW of target protein)