DOK6 antibody (Middle Region)

Catalog No. ABIN633168

Product Details anti-DOK6 Antibody

Target: DOK6 (Docking Protein 6 (DOK6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DOK6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DOK6 antibody was raised against the middle region of DOK6

Purification: Affinity purified

Immunogen: DOK6 antibody was raised using the middle region of DOK6 corresponding to a region with amino acids IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DOK6 Blocking Peptide, catalog no. 33R-4227, is also available for use as a blocking control in assays to test for specificity of this DOK6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DOK6

Target: DOK6 (Docking Protein 6 (DOK6))

Alternative Name: DOK6 (DOK6 Products)

Synonyms: DOK5L antibody, HsT3226 antibody, Dok-6 antibody, RGD1564376 antibody, docking protein 6 antibody, DOK6 antibody, Dok6 antibody

Background: DOK6 is a member of the DOK family of intracellular adaptors that play a role in the RET signaling cascade.

Molecular Weight: 38 kDa (MW of target protein)