CHRNA1 antibody

Catalog No. ABIN633174

Product Details anti-CHRNA1 Antibody

Target: CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNA1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV

Application Details

Application Notes: WB: 1.8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHRNA1 Blocking Peptide, catalog no. 33R-9265, is also available for use as a blocking control in assays to test for specificity of this CHRNA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHRNA1

Target: CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))

Alternative Name: CHRNA1 (CHRNA1 Products)

Synonyms: CHRNA1 antibody, ACHRA antibody, ACHRD antibody, CHRNA antibody, CMS2A antibody, FCCMS antibody, SCCMS antibody, NACHRA1 antibody, AI385656 antibody, AI608266 antibody, Achr-1 antibody, Acra antibody, cholinergic receptor nicotinic alpha 1 subunit antibody, cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) antibody, CHRNA1 antibody, Chrna1 antibody

Background: The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development