Retinoic Acid Receptor alpha antibody (N-Term)

Catalog No. ABIN633182

Product Details anti-Retinoic Acid Receptor alpha Antibody

Target: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Retinoic Acid Receptor alpha antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RARA antibody was raised against the N terminal of RARA

Purification: Affinity purified

Immunogen: RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids YESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RARA Blocking Peptide, catalog no. 33R-10090, is also available for use as a blocking control in assays to test for specificity of this RARA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Retinoic Acid Receptor alpha

Target: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Alternative Name: RARA (RARA Products)

Synonyms: NR1B1 antibody, RAR antibody, Nr1b1 antibody, RARalpha1 antibody, rar-alpha antibody, etID309833.12 antibody, rara antibody, rara2a antibody, zRAR antibody, zRAR-alpha antibody, zgc:109797 antibody, nr1b1 antibody, RAR-ALPHA1 antibody, HS-RARa antibody, fj66e06 antibody, rara2b antibody, wu:fj66e06 antibody, retinoic acid receptor alpha antibody, retinoic acid receptor, alpha antibody, retinoic acid receptor, alpha a antibody, retinoic acid receptor alpha L homeolog antibody, retinoic acid receptor, alpha b antibody, RARA antibody, Rara antibody, LOC100136372 antibody, raraa antibody, rara.L antibody, rara antibody, rarab antibody

Background: Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor, which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1, SMRT, and histone deacetylase. When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases, and the basic transcription machinery.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, S100 Proteins