DNA2 antibody (Middle Region)

Catalog No. ABIN633186

Product Details anti-DNA2 Antibody

Target: DNA2 (DNA Replication Helicase 2 Homolog (DNA2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DNA2 L antibody was raised against the middle region of Dna2

Purification: Affinity purified

Immunogen: DNA2 L antibody was raised using the middle region of Dna2 corresponding to a region with amino acids KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNA2L Blocking Peptide, catalog no. 33R-4506, is also available for use as a blocking control in assays to test for specificity of this DNA2L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNA2

Target: DNA2 (DNA Replication Helicase 2 Homolog (DNA2))

Alternative Name: DNA2L (DNA2 Products)

Synonyms: DNA2L antibody, Dna2l antibody, E130315B21Rik antibody, PEOA6 antibody, hDNA2 antibody, XDna2 antibody, dna2-A antibody, DNA replication helicase/nuclease 2 antibody, DNA replication helicase/nuclease 2 S homeolog antibody, DNA2 antibody, Dna2 antibody, dna2.S antibody

Background: DNA2L belongs to the DNA2/NAM7 helicase family. It may function in chromosomal DNA replication.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA