SRSF1 antibody
-
- Target See all SRSF1 Antibodies
- SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))
-
Reactivity
- Human, Mouse, Rat, Zebrafish (Danio rerio), Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SRSF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SFRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
- Top Product
- Discover our top product SRSF1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFRS1 Blocking Peptide, catalog no. 33R-2415, is also available for use as a blocking control in assays to test for specificity of this SFRS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))
- Alternative Name
- SFRS1 (SRSF1 Products)
- Synonyms
- ASF antibody, SF2 antibody, SF2p33 antibody, SFRS1 antibody, SRp30a antibody, 1110054N12Rik antibody, 5730507C05Rik antibody, 6330415C05Rik antibody, AI482334 antibody, AW491331 antibody, Asf antibody, Sf2 antibody, Sfrs1 antibody, DKFZp469K2419 antibody, sfrs1 antibody, sfrs1b antibody, wu:fb80g05 antibody, zgc:111894 antibody, zgc:65898 antibody, zgc:76897 antibody, asf antibody, sf2 antibody, sf2p33 antibody, srp30a antibody, sfrs1a antibody, sfrs1l antibody, wu:fb52g10 antibody, wu:fb97g12 antibody, zgc:66146 antibody, serine and arginine rich splicing factor 1 antibody, serine/arginine-rich splicing factor 1 antibody, serine/arginine-rich splicing factor 1b antibody, serine/arginine-rich splicing factor 1 L homeolog antibody, serine/arginine-rich splicing factor 1a antibody, SRSF1 antibody, Srsf1 antibody, srsf1b antibody, srsf1.L antibody, srsf1a antibody
- Background
- SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-