SUPV3L1 antibody

Catalog No. ABIN633189

Product Details anti-SUPV3L1 Antibody

Target: SUPV3L1 (Suppressor of Var1, 3-Like 1 (SUPV3L1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUPV3L1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SUPV3 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SUPV3L1 Blocking Peptide, catalog no. 33R-7571, is also available for use as a blocking control in assays to test for specificity of this SUPV3L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUPV0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SUPV3L1

Target: SUPV3L1 (Suppressor of Var1, 3-Like 1 (SUPV3L1))

Alternative Name: SUPV3L1 (SUPV3L1 Products)

Synonyms: SUV3 antibody, 6330443E10Rik antibody, wu:fc19b02 antibody, wu:fe37e06 antibody, Suv3 like RNA helicase antibody, suppressor of var1, 3-like 1 (S. cerevisiae) antibody, SUV3-like helicase antibody, SUPV3L1 antibody, Supv3l1 antibody, supv3l1 antibody

Background: SUPV3L1 is an ATPase and DNA/RNA helicase able to unwind DNA/DNA, DNA/RNA and RNA/RNA duplexes in the 5'-3' direction. SUPV3L1 may protect cells from apoptosis.

Molecular Weight: 88 kDa (MW of target protein)