SFRS6 antibody (Middle Region)

Catalog No. ABIN633190

Product Details anti-SFRS6 Antibody

Target: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRS6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SFRS6 antibody was raised against the middle region of SFRS6

Purification: Affinity purified

Immunogen: SFRS6 antibody was raised using the middle region of SFRS6 corresponding to a region with amino acids KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS6 Blocking Peptide, catalog no. 33R-4356, is also available for use as a blocking control in assays to test for specificity of this SFRS6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRS6

Target: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Alternative Name: SFRS6 (SRSF6 Products)

Synonyms: B52 antibody, SFRS6 antibody, SRP55 antibody, 1210001E11Rik antibody, AI314910 antibody, AW146126 antibody, Sfrs6 antibody, b52 antibody, sfrs6 antibody, srp55 antibody, sfrs6b antibody, wu:faa54g02 antibody, wu:fc17h09 antibody, zgc:103497 antibody, fa12h12 antibody, sfrs6a antibody, wu:fa12h12 antibody, wu:fa13e06 antibody, zgc:63770 antibody, serine and arginine rich splicing factor 6 antibody, serine/arginine-rich splicing factor 6 antibody, serine/arginine-rich splicing factor 6 S homeolog antibody, serine/arginine-rich splicing factor 6b antibody, serine/arginine-rich splicing factor 6a antibody, SRSF6 antibody, Srsf6 antibody, srsf6.S antibody, srsf6b antibody, srsf6a antibody

Background: SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization