DDX52 antibody
-
- Target See all DDX52 Antibodies
- DDX52 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 52 (DDX52))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDX52 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DDX52 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKRE
- Top Product
- Discover our top product DDX52 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX52 Blocking Peptide, catalog no. 33R-10066, is also available for use as a blocking control in assays to test for specificity of this DDX52 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX52 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX52 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 52 (DDX52))
- Alternative Name
- DDX52 (DDX52 Products)
- Synonyms
- HUSSY19 antibody, ROK1 antibody, 2700029C06Rik antibody, Rok1 antibody, DExD-box helicase 52 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 52 antibody, DEAD-box helicase 52 S homeolog antibody, DEAD-box helicase 52 antibody, DDX52 antibody, ddx52 antibody, ddx52.S antibody, Ddx52 antibody
- Background
- The function of DDX52 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 67 kDa (MW of target protein)
-