DDX52 antibody

Catalog No. ABIN633198

Product Details anti-DDX52 Antibody

Target: DDX52 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 52 (DDX52))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX52 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DDX52 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX52 Blocking Peptide, catalog no. 33R-10066, is also available for use as a blocking control in assays to test for specificity of this DDX52 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX52

Target: DDX52 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 52 (DDX52))

Alternative Name: DDX52 (DDX52 Products)

Synonyms: HUSSY19 antibody, ROK1 antibody, 2700029C06Rik antibody, Rok1 antibody, DExD-box helicase 52 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 52 antibody, DEAD-box helicase 52 S homeolog antibody, DEAD-box helicase 52 antibody, DDX52 antibody, ddx52 antibody, ddx52.S antibody, Ddx52 antibody

Background: The function of DDX52 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 67 kDa (MW of target protein)