PTBP1 antibody (Middle Region)

Catalog No. ABIN633200

Product Details anti-PTBP1 Antibody

Target: PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTBP1 antibody was raised against the middle region of PTBP1

Purification: Affinity purified

Immunogen: PTBP1 antibody was raised using the middle region of PTBP1 corresponding to a region with amino acids KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTBP1 Blocking Peptide, catalog no. 33R-4388, is also available for use as a blocking control in assays to test for specificity of this PTBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTBP1

Target: PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))

Alternative Name: PTBP1 (PTBP1 Products)

Synonyms: HNRNP-I antibody, HNRNPI antibody, HNRPI antibody, PTB antibody, PTB-1 antibody, PTB-T antibody, PTB2 antibody, PTB3 antibody, PTB4 antibody, pPTB antibody, Ptb antibody, hnrpi antibody, hnrnp-I antibody, vgrbp60 antibody, AA407203 antibody, AL033359 antibody, Pybp antibody, Pybp1 antibody, Pybp2 antibody, ptbp1 antibody, wu:fb99f12 antibody, zgc:110689 antibody, ptb antibody, ATPTB1 antibody, POLYPYRIMIDINE TRACT-BINDING antibody, POLYPYRIMIDINE TRACT-BINDING PROTEIN 1 antibody, T4P13.16 antibody, T4P13_16 antibody, polypyrimidine tract-binding protein 1 antibody, PTBP1 antibody, polypyrimidine tract binding protein 1 antibody, polypyrimidine tract binding protein 1 S homeolog antibody, polypyrimidine tract-binding protein antibody, polypyrimidine tract binding protein 1a antibody, polypyrimidine tract binding protein 1 L homeolog antibody, polypyrimidine tract-binding protein 1 antibody, PTBP1 antibody, ptbp1.S antibody, NAEGRDRAFT_80143 antibody, LOC100285404 antibody, Ptbp1 antibody, ptbp1a antibody, ptbp1.L antibody, PTB1 antibody, LOC100061673 antibody

Background: PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation