ZCCHC17 antibody (Middle Region)
-
- Target See all ZCCHC17 Antibodies
- ZCCHC17 (Zinc Finger, CCHC Domain Containing 17 (ZCCHC17))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZCCHC17 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZCCHC17 antibody was raised against the middle region of ZCCHC17
- Purification
- Affinity purified
- Immunogen
- ZCCHC17 antibody was raised using the middle region of ZCCHC17 corresponding to a region with amino acids CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH
- Top Product
- Discover our top product ZCCHC17 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZCCHC17 Blocking Peptide, catalog no. 33R-1685, is also available for use as a blocking control in assays to test for specificity of this ZCCHC17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZCCHC17 (Zinc Finger, CCHC Domain Containing 17 (ZCCHC17))
- Alternative Name
- ZCCHC17 (ZCCHC17 Products)
- Synonyms
- HSPC251 antibody, PS1D antibody, RP11-266K22.1 antibody, pNO40 antibody, ps1d antibody, zgc:65790 antibody, zgc:85656 antibody, RGD1565267 antibody, pno40 antibody, hspc251 antibody, 2810055E05Rik antibody, LDC4 antibody, pS1D antibody, DKFZp459G2227 antibody, zinc finger CCHC-type containing 17 antibody, zinc finger, CCHC domain containing 17 antibody, zinc finger CCHC-type containing 17 L homeolog antibody, ZCCHC17 antibody, zcchc17 antibody, zcchc17.L antibody, Zcchc17 antibody
- Background
- ZCCHC17 contains 1 CCHC-type zinc finger and 1 S1 motif domain. The exact function of ZDHHC19 remains unknown.
- Molecular Weight
- 27 kDa (MW of target protein)
-