DROSHA antibody (Middle Region)

Catalog No. ABIN633216

Product Details anti-DROSHA Antibody

Target: DROSHA (Drosha, Ribonuclease Type III (DROSHA))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DROSHA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNASEN antibody was raised against the middle region of RNASEN

Purification: Affinity purified

Immunogen: RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNASEN Blocking Peptide, catalog no. 33R-1038, is also available for use as a blocking control in assays to test for specificity of this RNASEN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DROSHA

Target: DROSHA (Drosha, Ribonuclease Type III (DROSHA))

Alternative Name: RNASEN (DROSHA Products)

Synonyms: im:7150667 antibody, zgc:158612 antibody, ETOHI2 antibody, HSA242976 antibody, RANSE3L antibody, RN3 antibody, RNASE3L antibody, RNASEN antibody, 1110013A17Rik antibody, AI874853 antibody, Etohi2 antibody, Rn3 antibody, Rnasen antibody, RGD1307626 antibody, ribonuclease type III, nuclear antibody, Ribonuclease 3 antibody, ribonuclease 3 antibody, drosha ribonuclease III antibody, drosha, ribonuclease type III antibody, rnasen antibody, Thicy_0885 antibody, Sinme_0866 antibody, Isova_2087 antibody, Sphch_0770 antibody, DROSHA antibody, Drosha antibody

Background: RNASEN is a ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus.

Molecular Weight: 159 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways