PABP antibody
-
- Target See all PABP (PABPC1) Antibodies
- PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PABP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
- Top Product
- Discover our top product PABPC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PABPC1 Blocking Peptide, catalog no. 33R-5379, is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))
- Alternative Name
- PABPC1 (PABPC1 Products)
- Synonyms
- PAB1 antibody, PABP antibody, PABP1 antibody, PABPC2 antibody, PABPL1 antibody, Pabp1 antibody, PabpI antibody, Pabpl1 antibody, ePAB antibody, Pabp antibody, pab1 antibody, pabp antibody, pabp1 antibody, pabpc1 antibody, pabpc2 antibody, PABPC1 antibody, wu:fb16a02 antibody, wu:fi19b08 antibody, wu:fj12d09 antibody, wu:fj61f06 antibody, zgc:109879 antibody, zgc:77608 antibody, poly(A) binding protein cytoplasmic 1 antibody, poly(A) binding protein, cytoplasmic 1 antibody, poly(A) binding protein, cytoplasmic 1 S homeolog antibody, poly(A) binding protein cytoplasmic 1 like antibody, poly(A) binding protein, cytoplasmic 1 L homeolog antibody, poly(A) binding protein, cytoplasmic 1a antibody, poly A binding protein, cytoplasmic 1 b antibody, PABPC1 antibody, Pabpc1 antibody, pabpc1.S antibody, pabpc1 antibody, PABPC1L antibody, pabpc1.L antibody, pabpc1a antibody, pabpc1b antibody
- Background
- The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation.
- Molecular Weight
- 71 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-