SHPRH antibody (N-Term)

Catalog No. ABIN633252

Product Details anti-SHPRH Antibody

Target: SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHPRH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SHPRH antibody was raised against the N terminal of SHPRH

Purification: Affinity purified

Immunogen: SHPRH antibody was raised using the N terminal of SHPRH corresponding to a region with amino acids SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SHPRH Blocking Peptide, catalog no. 33R-8531, is also available for use as a blocking control in assays to test for specificity of this SHPRH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHPRH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHPRH

Target: SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))

Alternative Name: SHPRH (SHPRH Products)

Synonyms: bA545I5.2 antibody, 2610103K11Rik antibody, AA450458 antibody, AU024614 antibody, BC006883 antibody, D230017O13Rik antibody, E130018M05 antibody, SNF2 histone linker PHD RING helicase antibody, SHPRH antibody, Shprh antibody

Background: SHPRH is a ubiquitously expressed protein that contains motifs characteristics of several DNA repair proteins, transcription factors, and helicases.

Molecular Weight: 190 kDa (MW of target protein)