Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

MTR4 antibody (Superkiller Viralicidic Activity 2-Like 2) Primary Antibody

SKIV2L2 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN633265
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    MTR4 (SKIV2L2)
    Reactivity
    • 36
    • 16
    • 11
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 36
    Rabbit
    Clonality
    • 36
    Polyclonal
    Conjugate
    • 17
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This MTR4 antibody is un-conjugated
    Application
    • 29
    • 18
    • 8
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purification
    Affinity purified
    Immunogen
    SKIV2 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEE
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    SKIV2L2 Blocking Peptide, catalog no. 33R-4397, is also available for use as a blocking control in assays to test for specificity of this SKIV2L2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKIV0 2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    MTR4 (SKIV2L2)
    Alternative Name
    SKIV2L2 (SKIV2L2 Antibody Abstract)
    Synonyms
    RGD1305984, zgc:63838, wu:fd11a05, SKIV2L2, skiv2l2, Dob1, KIAA0052, Mtr4, fSAP118, 2610528A15Rik, mKIAA0052, Ski2 like RNA helicase 2, superkiller viralicidic activity 2-like 2, superkiller viralicidic activity 2-like 2 (S. cerevisiae), Skiv2l2, skiv2l2, SKIV2L2, LOC100380870
    Background
    SKIV2L2 may be involved in pre-mRNA splicing.
    Molecular Weight
    118 kDa (MW of target protein)
You are here:
help Support