AARS antibody (N-Term)

Catalog No. ABIN633270

Product Details anti-AARS Antibody

Target: AARS (Alanyl tRNA Synthetase (AARS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AARS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AARS antibody was raised against the N terminal of AARS

Purification: Affinity purified

Immunogen: AARS antibody was raised using the N terminal of AARS corresponding to a region with amino acids DSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AARS Blocking Peptide, catalog no. 33R-2181, is also available for use as a blocking control in assays to test for specificity of this AARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AARS

Target: AARS (Alanyl tRNA Synthetase (AARS))

Alternative Name: AARS (AARS Products)

Synonyms: im:7146712 antibody, si:ch211-223o1.6 antibody, wu:fc48h07 antibody, zgc:113920 antibody, CMT2N antibody, AI316495 antibody, C76919 antibody, sti antibody, alanyl-tRNA synthetase antibody, alanyl-tRNA synthetase L homeolog antibody, aars antibody, aars.L antibody, AARS antibody, Aars antibody, LOC693023 antibody

Background: The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein.

Molecular Weight: 107 kDa (MW of target protein)