Pre-mRNA Branch Site Protein p14 (SF3B14) (Middle Region) antibody
-
- Target See all Pre-mRNA Branch Site Protein p14 (SF3B14) Antibodies
- Pre-mRNA Branch Site Protein p14 (SF3B14)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SF3 B14 antibody was raised against the middle region of SF3 14
- Purification
- Affinity purified
- Immunogen
- SF3 B14 antibody was raised using the middle region of SF3 14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
- Top Product
- Discover our top product SF3B14 Primary Antibody
-
-
- Application Notes
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SF3B14 Blocking Peptide, catalog no. 33R-3788, is also available for use as a blocking control in assays to test for specificity of this SF3B14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pre-mRNA Branch Site Protein p14 (SF3B14)
- Alternative Name
- SF3B14 (SF3B14 Products)
- Synonyms
- 6030419K15Rik antibody, AV001342 antibody, Sf3b14 antibody, zgc:86708 antibody, HSPC175 antibody, Ht006 antibody, P14 antibody, SAP14 antibody, SF3B14a antibody, splicing factor 3B, subunit 6 antibody, splicing factor 3b, subunit 6 antibody, splicing factor 3b subunit 6 S homeolog antibody, splicing factor 3b subunit 6 antibody, Sf3b6 antibody, sf3b6 antibody, sf3b6.S antibody, SF3B6 antibody
- Background
- SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.
- Molecular Weight
- 14 kDa (MW of target protein)
-