IMP3 antibody

Catalog No. ABIN633282

Product Details anti-IMP3 Antibody

Target: IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IMP3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: IMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IMP3 Blocking Peptide, catalog no. 33R-3318, is also available for use as a blocking control in assays to test for specificity of this IMP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IMP3

Target: IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))

Alternative Name: IMP3 (IMP3 Products)

Synonyms: BRMS2 antibody, C15orf12 antibody, MRPS4 antibody, 1190002L16Rik antibody, AI256594 antibody, RGD1306825 antibody, zgc:56526 antibody, imp3 antibody, IMP3, U3 small nucleolar ribonucleoprotein antibody, IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast) antibody, inositol monophosphatase domain containing 1 antibody, IMP3, U3 small nucleolar ribonucleoprotein L homeolog antibody, IMP3 antibody, Imp3 antibody, imp3 antibody, IMPAD1 antibody, imp3.L antibody

Background: This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.

Molecular Weight: 22 kDa (MW of target protein)