BCAS2 antibody (Middle Region)
-
- Target See all BCAS2 Antibodies
- BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BCAS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BCAS2 antibody was raised against the middle region of BCAS2
- Purification
- Affinity purified
- Immunogen
- BCAS2 antibody was raised using the middle region of BCAS2 corresponding to a region with amino acids SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
- Top Product
- Discover our top product BCAS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BCAS2 Blocking Peptide, catalog no. 33R-8559, is also available for use as a blocking control in assays to test for specificity of this BCAS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))
- Alternative Name
- BCAS2 (BCAS2 Products)
- Synonyms
- DAM1 antibody, SPF27 antibody, Snt309 antibody, 6430539P16Rik antibody, AI132645 antibody, C76366 antibody, C80030 antibody, BCAS2 antibody, cb302 antibody, zgc:101730 antibody, BCAS2, pre-mRNA processing factor antibody, breast carcinoma amplified sequence 2 antibody, breast carcinoma amplified sequence 2 L homeolog antibody, BCAS2 antibody, Bcas2 antibody, bcas2 antibody, bcas2.L antibody, CpipJ_CPIJ003889 antibody
- Background
- BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function.
- Molecular Weight
- 26 kDa (MW of target protein)
-