DND1 antibody

Catalog No. ABIN633302

Product Details anti-DND1 Antibody

Target: DND1 (Dead End Homolog 1 (DND1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DND1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DND1 Blocking Peptide, catalog no. 33R-3840, is also available for use as a blocking control in assays to test for specificity of this DND1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DND1

Target: DND1 (Dead End Homolog 1 (DND1))

Alternative Name: DND1 (DND1 Products)

Background: DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration.

Molecular Weight: 39 kDa (MW of target protein)