UPF3A antibody

Catalog No. ABIN633304

Product Details anti-UPF3A Antibody

Target: UPF3A (UPF3 Regulator of Nonsense Transcripts Homolog A (UPF3A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UPF3A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UPF3 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UPF3A Blocking Peptide, catalog no. 33R-7719, is also available for use as a blocking control in assays to test for specificity of this UPF3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UPF3A

Target: UPF3A (UPF3 Regulator of Nonsense Transcripts Homolog A (UPF3A))

Alternative Name: UPF3A (UPF3A Products)

Synonyms: 2600001C03Rik antibody, 4930546M19Rik antibody, RENT3A antibody, UPF3 antibody, UPF3A antibody, HUPF3A antibody, si:dkey-21o13.6 antibody, UPF3 regulator of nonsense transcripts homolog A (yeast) antibody, UPF3A, regulator of nonsense mediated mRNA decay antibody, Upf3a antibody, UPF3A antibody, upf3a antibody

Background: UPF3A is part of a multiprotein post-splicing mRNP complex involved in both mRNA nuclear export and mRNA surveillance. UPF3A is involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.

Molecular Weight: 55 kDa (MW of target protein)