KARS antibody (C-Term)

Catalog No. ABIN633328

Product Details anti-KARS Antibody

Target: KARS (Lysyl-tRNA Synthetase (KARS))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KARS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KARS antibody was raised against the C terminal of KARS

Purification: Affinity purified

Immunogen: KARS antibody was raised using the C terminal of KARS corresponding to a region with amino acids GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KARS Blocking Peptide, catalog no. 33R-3434, is also available for use as a blocking control in assays to test for specificity of this KARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KARS

Target: KARS (Lysyl-tRNA Synthetase (KARS))

Alternative Name: KARS (KARS Products)

Synonyms: CG12141 antibody, Dmel\\CG12141 antibody, KRS antibody, LysRS antibody, cb530 antibody, wu:fa16h02 antibody, zgc:92483 antibody, kars antibody, MGC53345 antibody, kars2 antibody, krs antibody, krs-1 antibody, KARS antibody, Tb06.28P18.190 antibody, CMTRIB antibody, DFNB89 antibody, KARS1 antibody, KARS2 antibody, AA589550 antibody, AL024334 antibody, AL033315 antibody, AL033367 antibody, D8Ertd698e antibody, D8Wsu108e antibody, mKIAA0070 antibody, Lysyl-tRNA synthetase antibody, lysyl-tRNA synthetase antibody, lysyl-tRNA synthetase S homeolog antibody, lysyl-tRNA synthetase L homeolog antibody, LysRS antibody, kars antibody, kars.S antibody, kars.L antibody, Bm1_16500 antibody, lysS antibody, Taci_1118 antibody, Tpau_1737 antibody, Arch_0261 antibody, Trad_2960 antibody, Spirs_3699 antibody, KARS antibody, LOC100280510 antibody, Tb927.6.1510 antibody, Kars antibody

Background: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.

Molecular Weight: 66 kDa (MW of target protein)