TROVE2 antibody (N-Term)

Catalog No. ABIN633333

Product Details anti-TROVE2 Antibody

Target: TROVE2 (TROVE Domain Family, Member 2 (TROVE2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TROVE2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: TROVE2 antibody was raised against the N terminal of TROVE2

Purification: Affinity purified

Immunogen: TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TROVE2 Blocking Peptide, catalog no. 33R-7498, is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TROVE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TROVE2

Target: TROVE2 (TROVE Domain Family, Member 2 (TROVE2))

Alternative Name: TROVE2 (TROVE2 Products)

Synonyms: SSA2 antibody, TROVE2 antibody, ssa2 antibody, ssa2-A antibody, RO60 antibody, RORNP antibody, 1810007I17Rik antibody, A530054J02Rik antibody, AI646302 antibody, SS-A/Ro antibody, Ssa antibody, Ssa2 antibody, TROVE domain family member 2 antibody, TROVE domain family, member 2 antibody, TROVE domain family member 2 L homeolog antibody, TROVE2 antibody, trove2 antibody, trove2.L antibody, Trove2 antibody

Background: TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.

Molecular Weight: 58 kDa (MW of target protein)