HDLBP antibody

Catalog No. ABIN633334

Product Details anti-HDLBP Antibody

Target: HDLBP (High Density Lipoprotein Binding Protein (HDLBP))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HDLBP antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HDLBP Blocking Peptide, catalog no. 33R-6516, is also available for use as a blocking control in assays to test for specificity of this HDLBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDLBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HDLBP

Target: HDLBP (High Density Lipoprotein Binding Protein (HDLBP))

Alternative Name: HDLBP (HDLBP Products)

Synonyms: HBP antibody, PRO2900 antibody, VGL antibody, 1110005P14Rik antibody, AA960365 antibody, AI118566 antibody, D1Ertd101e antibody, HDLBP antibody, vigilin antibody, cb591 antibody, cb811 antibody, hdlbp antibody, wu:fb36d01 antibody, wu:fb94h08 antibody, wu:fc23d06 antibody, wu:fc75h07 antibody, high density lipoprotein binding protein antibody, high density lipoprotein (HDL) binding protein antibody, vigilin antibody, high density lipoprotein binding protein (vigilin) S homeolog antibody, high density lipoprotein binding protein a antibody, HDLBP antibody, Hdlbp antibody, hdlbp.S antibody, hdlbpa antibody

Background: HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.

Molecular Weight: 141 kDa (MW of target protein)