THOC1 antibody (C-Term)

Catalog No. ABIN633337

Product Details anti-THOC1 Antibody

Target: THOC1 (THO Complex 1 (THOC1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This THOC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: THOC1 antibody was raised against the C terminal of THOC1

Purification: Affinity purified

Immunogen: THOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THOC1 Blocking Peptide, catalog no. 33R-9212, is also available for use as a blocking control in assays to test for specificity of this THOC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for THOC1

Target: THOC1 (THO Complex 1 (THOC1))

Alternative Name: THOC1 (THOC1 Products)

Synonyms: p84 antibody, MGC114861 antibody, Tho1 antibody, THOC1 antibody, Hpr1 antibody, HPR1 antibody, P84 antibody, P84N5 antibody, 3110002N20Rik antibody, AW107452 antibody, NMP-84 antibody, LRRGT00070 antibody, THO complex 1 antibody, THO complex 1 protein L homeolog antibody, THO complex subunit 1 antibody, THO complex 1 protein antibody, thoc1 antibody, thoc1.L antibody, THOC1 antibody, LOC100123388 antibody, Thoc1 antibody

Background: THOC1 is part of the TREX (transcription/export) complex, which includes TEX1, THO2, ALY, and UAP56.

Molecular Weight: 76 kDa (MW of target protein)