SRP19 antibody (Middle Region)

Catalog No. ABIN633423

Product Details anti-SRP19 Antibody

Target: SRP19 (Signal Recognition Particle 19kDa (SRP19))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRP19 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SRP19 antibody was raised against the middle region of SRP19

Purification: Affinity purified

Immunogen: SRP19 antibody was raised using the middle region of SRP19 corresponding to a region with amino acids CLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRP19 Blocking Peptide, catalog no. 33R-1750, is also available for use as a blocking control in assays to test for specificity of this SRP19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRP19

Target: SRP19 (Signal Recognition Particle 19kDa (SRP19))

Alternative Name: SRP19 (SRP19 Products)

Synonyms: 2310020D23Rik antibody, zgc:63961 antibody, CG4457 antibody, Dmel\\CG4457 antibody, SRP19 antibody, srp19 antibody, signal recognition particle 19 antibody, signal recognition particle 19kDa L homeolog antibody, signal recognition particle 19kDa antibody, Signal recognition particle protein 19 antibody, SRP19 antibody, srp19.L antibody, srp19 antibody, Srp19 antibody

Background: SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome