APOBEC3D antibody
-
- Target See all APOBEC3D Antibodies
- APOBEC3D (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3D (APOBEC3D))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APOBEC3D antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- ApoBEC3 D antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE
- Top Product
- Discover our top product APOBEC3D Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 12 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ApoBEC3D Blocking Peptide, catalog no. 33R-8959, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOBEC3D (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3D (APOBEC3D))
- Alternative Name
- ApoBEC3D (APOBEC3D Products)
- Background
- This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.
- Molecular Weight
- 30 kDa (MW of target protein)
-