LARP6 antibody (Middle Region)

Catalog No. ABIN633453

Product Details anti-LARP6 Antibody

Target: LARP6 (La Ribonucleoprotein Domain Family, Member 6 (LARP6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LARP6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LARP6 antibody was raised against the middle region of LARP6

Purification: Affinity purified

Immunogen: LARP6 antibody was raised using the middle region of LARP6 corresponding to a region with amino acids MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LARP6 Blocking Peptide, catalog no. 33R-6082, is also available for use as a blocking control in assays to test for specificity of this LARP6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LARP6

Target: LARP6 (La Ribonucleoprotein Domain Family, Member 6 (LARP6))

Alternative Name: LARP6 (LARP6 Products)

Synonyms: im:7142825 antibody, wu:fa55b04 antibody, ACHN antibody, 5430431G03Rik antibody, AI552438 antibody, Achn antibody, RGD1308414 antibody, La ribonucleoprotein domain family, member 6b antibody, La ribonucleoprotein domain family member 6 antibody, La ribonucleoprotein domain family, member 6 antibody, larp6b antibody, LARP6 antibody, Larp6 antibody

Background: The function of LARP6 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 55 kDa (MW of target protein)